PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010551470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 139aa    MW: 15871 Da    PI: 9.2495
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010551470.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.2e-15449247
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     ++WT+eE+ +++++  +lG+g+W++I+r    +Rt+ q+ s+ qky
   XP_010551470.1  4 NPWTEEEHMRFLRGLDELGKGDWRAISRNYVVTRTPTQVASHAQKY 49
                     69*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.625154IPR017930Myb domain
SMARTSM007171.1E-10252IPR001005SANT/Myb domain
SuperFamilySSF466891.05E-15454IPR009057Homeodomain-like
PfamPF002494.8E-13449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-11448IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-17552IPR006447Myb domain, plants
CDDcd001678.23E-11550No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MRGNPWTEEE HMRFLRGLDE LGKGDWRAIS RNYVVTRTPT QVASHAQKYF LRLNCLNNRR  60
RRGSSLFDIT IDSVTISRQE KPMVFPVIGE SSQTPIRMFQ PPVLRISDLS LNDRPPELFL  120
SLAMPSSPSS SDEPNPVDA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010551470.14e-99PREDICTED: transcription factor MYB1R1 isoform X2
SwissprotQ2V9B05e-26MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLV7CAD31e-33V7CAD3_PHAVU; Uncharacterized protein
STRINGPOPTR_0012s05720.18e-30(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.21e-27MYB_related family protein